Protein Info for ECD_04133 in Escherichia coli BL21

Annotation: L-idonate 5-dehydrogenase, NAD-binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF08240: ADH_N" amino acids 29 to 139 (111 residues), 98.1 bits, see alignment E=4.1e-32 PF00107: ADH_zinc_N" amino acids 180 to 304 (125 residues), 99.4 bits, see alignment E=2.4e-32 PF13602: ADH_zinc_N_2" amino acids 213 to 333 (121 residues), 28 bits, see alignment E=6.1e-10

Best Hits

Swiss-Prot: 100% identical to IDND_ECOLI: L-idonate 5-dehydrogenase (NAD(P)(+)) (idnD) from Escherichia coli (strain K12)

KEGG orthology group: K00098, L-idonate 5-dehydrogenase [EC: 1.1.1.264] (inferred from 100% identity to eco:b4267)

MetaCyc: 100% identical to L-idonate 5-dehydrogenase (Escherichia coli K-12 substr. MG1655)
L-idonate 5-dehydrogenase. [EC: 1.1.1.264]

Predicted SEED Role

"L-idonate 5-dehydrogenase (EC 1.1.1.264)" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.1.264)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.264

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>ECD_04133 L-idonate 5-dehydrogenase, NAD-binding (Escherichia coli BL21)
MQVKTQSCVVAGKKTVAVTEQTIDWNNNGTLVQITRGGICGSDLHYYQEGKVGNFMIKAP
MVLGHEVIGKVIHSDSSELHEGQTVAINPSKPCGHCKYCIEHNENQCTDMRFFGSAMYFP
HVDGGFTRYKMVETSQCVPYPAKADEKVMAFAEPLAVAIHAAHQAGELQGKRVFISGVGP
IGCLIVSAVKTLGAAEIVCADVSPRSLSLGKEMGADVLVNPQNDDMDHWKAEKGYFDVSF
EVSGHPSSVNTCLEVTRARGVMVQVGMGGAMAEFPMMTLIGKEISLRGSFRFTSEFNTAV
SWLANGVINPLPLLSAEYPFTDLEEALRFAGDKTQAAKVQLVF