Protein Info for ECD_04123 in Escherichia coli BL21

Annotation: DUF898 family inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 176 to 207 (32 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details PF05987: DUF898" amino acids 13 to 370 (358 residues), 160.1 bits, see alignment E=4.1e-51

Best Hits

Swiss-Prot: 99% identical to YJGN_ECO57: Inner membrane protein YjgN (yjgN) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to eco:b4257)

Predicted SEED Role

"Inner membrane protein YjgN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>ECD_04123 DUF898 family inner membrane protein (Escherichia coli BL21)
MAQVINEMDVPSHSFVFHGTGERYFLICVVNVLLTIITLGIYLPWALMKCKRYLYANMEV
NGQRFSYGITGGNVFFSCLVFVFFYFAILMTVSADMPLVGCVLTLSLLVLLIFMAAKGLR
YQALMTSLNGVRFSFNCSMKGFWWVTFFLPILMAIGMGTVFFISTKMLHANSSSSVIISV
VLMAIVGIVSIGIFNGTLYSLVMSFLWSNTSFGIHRFKVKLDTTYCIKYAILAFLALLPF
LAVAGYIIFDQILNAYDSSVYANDDIENLQQFMEMQRKMIIAQLIYYFGIAVSTSYLTVS
LRNHFMSNLSLNDGRIRFRSTLTYHGMLYRMCALVVISGITGGLAYPLLKIWMIDWQAKN
TYLLGDLDDLPLINKEEQPDKGFLASISRGIMPSLPFL