Protein Info for ECD_04098 in Escherichia coli BL21

Annotation: putative sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 62 to 130 (69 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 56 to 320 (265 residues), 180.3 bits, see alignment E=2.2e-57

Best Hits

Swiss-Prot: 99% identical to YTFT_ECOLI: Inner membrane ABC transporter permease protein YtfT (ytfT) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 99% identity to eco:b4230)

MetaCyc: 99% identical to galactofuranose ABC transporter putative membrane subunit YtfT (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, permease protein YtfT"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>ECD_04098 putative sugar ABC transporter permease (Escherichia coli BL21)
MPQSLPDTTPPKRRFRWPTGMPQLAALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDILN
RAAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVAGFSLPIVLLSALGTGILA
GLWNGILVAILKIQPFVATLILMVAGRGVAQLITSGQIVTFNSPDLSWFGSGSLLFLPTP
VIIAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAG
IIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILL
SGFPPEMNQVVKAVVVLCVLIVQSQRFISLIKGVRSRDKT