Protein Info for ECD_04086 in Escherichia coli BL21

Annotation: 3'(2'),5'-bisphosphate nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR01331: 3'(2'),5'-bisphosphate nucleotidase" amino acids 1 to 244 (244 residues), 376.5 bits, see alignment E=3.4e-117 PF00459: Inositol_P" amino acids 5 to 233 (229 residues), 176.4 bits, see alignment E=4.4e-56

Best Hits

Swiss-Prot: 100% identical to CYSQ_ECOL6: 3'(2'),5'-bisphosphate nucleotidase CysQ (cysQ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03677, CysQ protein (inferred from 99% identity to eco:b4214)

MetaCyc: 99% identical to 3'(2'),5'-bisphosphate nucleotidase (Escherichia coli K-12 substr. MG1655)
3'(2'),5'-bisphosphate nucleotidase. [EC: 3.1.3.7]

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>ECD_04086 3'(2'),5'-bisphosphate nucleotidase (Escherichia coli BL21)
MLDQVCQLARNAGDAIMQVYDGTKPMDVVSKADNSPVTAADIAAHTVIMDGLRTLTPDIP
VLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDHGKPILGVVYAPVM
NIMYSAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHADAELKEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQGKPLDYTPRESFLNPG
FRVSIY