Protein Info for ECD_04078 in Escherichia coli BL21

Annotation: OapA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details PF08525: OapA_N" amino acids 23 to 50 (28 residues), 34.8 bits, see alignment (E = 1.1e-12) PF04225: LysM_OapA" amino acids 127 to 211 (85 residues), 122.5 bits, see alignment E=6.1e-40

Best Hits

Swiss-Prot: 100% identical to YTFB_ECOLI: Cell division protein YtfB (ytfB) from Escherichia coli (strain K12)

KEGG orthology group: K07269, hypothetical protein (inferred from 100% identity to eco:b4206)

Predicted SEED Role

"Putative cell envelope opacity-associated protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>ECD_04078 OapA family protein (Escherichia coli BL21)
MPGRFELKPTLEKVWHAPDNFRFMDPLPPMHRRGIIIAAIILVVGFLLPSDDTPNAPVVT
REAQLDIQSQSQPPTEEQLRAQLVTPQNDPDQVAPVAPEPIQEGQPEEQPQTTQTQPFQP
DSGIDNQWRSYRVEPGKTMAQLFRDHGLPATDVYAMAQVEGAGKPLSNLQNGQMVKIRQN
ASGVVTGLTIDTGNNQQVLFTRQPDGSFIRAR