Protein Info for ECD_04074 in Escherichia coli BL21

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 14 to 257 (244 residues), 153.7 bits, E=5.7e-49
• PF16113: ECH_2
  • amino acids 16 to 241 (226 residues), 115.6 bits, E=3.6e-37

Best Hits

Swiss-Prot: 34% identical to HPCD_METS5: 3-hydroxypropionyl-coenzyme A dehydratase (Msed_2001) from Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)

KEGG orthology group: None (inferred from 97% identity to ecq:ECED1_5059)

MetaCyc: 34% identical to 3-hydroxypropionyl-CoA dehydratase (Metallosphaera sedula)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydratase (EC 4.2.1.55)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism (EC 4.2.1.55)

MetaCyc Pathways

• acrylate degradation II (3/3 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (6/10 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• β-alanine biosynthesis II (2/6 steps found)
• acrylate degradation I (1/5 steps found)
• propanoyl-CoA degradation II (1/5 steps found)
• glyoxylate assimilation (6/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
• ethylmalonyl-CoA pathway (2/11 steps found)

KEGG Metabolic Maps

• Butanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.55

Protein Sequence (258 amino acids)

>ECD_04074 hypothetical protein (Escherichia coli BL21)
MSDQPVLFSRAAASCRLTLNREDKCHAINEEMIESLDHYLNEIENDTTLRLVELTATGDK
FFCAGGDIKSWSAYSPLDMGRKWIKRGNDVFNRLRNLPQLTVANLNGHTIGGGIELALCC
DIRIARPGAKFSNPEVMLGMVPGWMGIERVLNQVGPVVGRQMLMLGKRLTAQEAQAANLI
DEVVEKEQVESWMANQLAQLEKCGPVALAHIKQLILALENKHADYPHQLLAGLMSATQDC
QQATRAFAEKSSVSFHNQ