Protein Info for ECD_04071 in Escherichia coli BL21

Annotation: Hexuronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 48 to 69 (22 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 229 to 254 (26 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 359 to 383 (25 residues), see Phobius details amino acids 386 to 411 (26 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 327 (313 residues), 187.7 bits, see alignment E=3e-59 PF00083: Sugar_tr" amino acids 43 to 407 (365 residues), 25.8 bits, see alignment E=5.1e-10

Best Hits

Swiss-Prot: 48% identical to EXUT_ECO57: Hexuronate transporter (exuT) from Escherichia coli O157:H7

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to ecz:ECS88_4792)

MetaCyc: 48% identical to hexuronate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-123; TRANS-RXN-35

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>ECD_04071 Hexuronate transporter (Escherichia coli BL21)
MNKIKNYRWHMIALVCFITVINYLDRTALGIAAPTIMETTGITKEQYSWIVSAFQLAYTL
GQPVMGFFIDTVGLKLSFAICAAIWGLATMGHALTGTWSGLAFMRALMGFSEASAIPAGV
KTASTWFPAKERGVATGVFNMGTSLGAMLAPPLIAWCIMFHSWQFAFIVSGSLALLAALF
WFFCYKDPKDAKRLSDEERHYIESGQEQHLKTDKKEKTSIKHILSQRNFWGIGIARFLAD
PAWGTINFWVPIFFVETLHFSLKEIAMFVWLPFLLGDLGCLASGFVAKFFHDRGVSLINS
RRITFTIAAVIMMTIGLVSIVENPYIAVLLISIGAFSHQCLSTVAATLGGDLFKKDEVAT
AVGMAGACAWSGQLIFNLFIGAFVHIIGFAPFFIALAFFDIIGAIALWTLIKVKDEEPQV
QLATS