Protein Info for ECD_04041 in Escherichia coli BL21

Annotation: modulator for HflB protease specific for phage lambda cII repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 77 to 100 (24 residues), see Phobius details PF12221: HflK_N" amino acids 1 to 59 (59 residues), 61.4 bits, see alignment E=6.5e-21 TIGR01933: HflK protein" amino acids 97 to 356 (260 residues), 415.3 bits, see alignment E=4.8e-129 PF01145: Band_7" amino acids 99 to 270 (172 residues), 111.7 bits, see alignment E=4.3e-36

Best Hits

Swiss-Prot: 100% identical to HFLK_ECOLI: Modulator of FtsH protease HflK (hflK) from Escherichia coli (strain K12)

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 100% identity to eco:b4174)

MetaCyc: 100% identical to regulator of FtsH protease (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>ECD_04041 modulator for HflB protease specific for phage lambda cII repressor (Escherichia coli BL21)
MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG
TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSHLVEP
GLNWKPTFIDEVKPVNVEAVRELAASGVMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSP
DDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQA
ARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEARAYKAQTILE
AQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQMLK
GGNAPAAKSDNGASNLLRLPPASSSTTSGASNTSSTSQGDIMDQRRANAQRNDYQRQGE