Protein Info for ECD_04028 in Escherichia coli BL21

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details amino acids 466 to 484 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 9 to 471 (463 residues), 90.3 bits, see alignment E=1.4e-29 PF00324: AA_permease" amino acids 24 to 465 (442 residues), 42.7 bits, see alignment E=3.2e-15

Best Hits

Swiss-Prot: 98% identical to YJEM_ECOLI: Inner membrane transporter YjeM (yjeM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b4156)

Predicted SEED Role

"Putative amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>ECD_04028 putative transporter (Escherichia coli BL21)
MPHTIKKMSLIGLILMIFTSVFGFANSPSAYYLMGYSAIPFYIFSALLFFIPFALMMAEM
GAAYRKEEGGIYSWMNNSVGPRFAFIGTFMWFSSYIIWMVSTSAKVWVPFSTFLYGSDMT
QHWRIAGLEPTQVVGLLAVAWMILVTVVASKGINKIARITAVGGIAVMCLNLVLLLVSIT
ILLLNGGHFAQDINFLASPNPGYQSGLAMLSFVVFAIFAYGGIEAVGGLVDKTENPEKNF
AKGIVFAAIVISIGYSLAIFLWGVSTNWQQVLSNGSVNLGNITYVLMKSLGVTLGNALHL
SPEASLSLGVWFARITGLSMFLAYTGAFFTLCYSPLKAIIQGTPKALWPEPMTRLNAMGM
PSIAMWMQCGLVTVFILLVSFGGGTASAFFNKLTLMANVSMTLPYLFLALAFPFFKARQD
LDRPFVIFKTRMSAMIATVVVVLVVTFANVFTIIQPVVEAGDWDSTLWMIGGPVFFSLLA
MAIYQNYCSRMANKPELALD