Protein Info for ECD_04021 in Escherichia coli BL21

Annotation: outer membrane lipoprotein cell division and growth lipocalin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF08212: Lipocalin_2" amino acids 35 to 174 (140 residues), 153.4 bits, see alignment E=4.3e-49 PF00061: Lipocalin" amino acids 41 to 170 (130 residues), 33.2 bits, see alignment E=5.8e-12

Best Hits

Swiss-Prot: 100% identical to BLC_ECO57: Outer membrane lipoprotein Blc (blc) from Escherichia coli O157:H7

KEGG orthology group: K03098, outer membrane lipoprotein Blc (inferred from 100% identity to eco:b4149)

Predicted SEED Role

"Outer membrane lipoprotein Blc"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>ECD_04021 outer membrane lipoprotein cell division and growth lipocalin (Escherichia coli BL21)
MRLLPLVAAATAAFLVVACSSPTPPRGVTVVNNFDAKRYLGTWYEIARFDHRFERGLEKV
TATYSLRDDGGLNVINKGYNPDRGMWQQSEGKAYFTGAPTRAALKVSFFGPFYGGYNVIA
LDREYRHALVCGPDRDYLWILSRTPTISDEVKQEMLAVATREGFDVSKFIWVQQPGSY