Protein Info for ECD_03952 in Escherichia coli BL21

Annotation: outer membrane factor of efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 19 to 478 (460 residues), 272.6 bits, see alignment E=3.1e-85 PF02321: OEP" amino acids 69 to 268 (200 residues), 33.6 bits, see alignment E=1.8e-12 amino acids 294 to 476 (183 residues), 39.9 bits, see alignment E=2.1e-14

Best Hits

Swiss-Prot: 100% identical to MDTP_ECOLI: Multidrug resistance outer membrane protein MdtP (mdtP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4080)

MetaCyc: 100% identical to putative multidrug efflux pump outer membrane channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-351

Predicted SEED Role

"Outer membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>ECD_03952 outer membrane factor of efflux pump (Escherichia coli BL21)
MINRQLSRLLLCSILGSTTLISGCALVRKDSAPHQQLKPEQIKLADDIHLASSGWPQAQW
WKQLNDPQLDALIQRTLSGSHTLAEAKLREEKAQSQADLLDAGSQLQVAALGMLNRQRVS
ANGFLSPYSMDAPALGMDGPYYTEATVGLFAGLDLDLWGVHRSAVAAAIGAHNAALAETA
AVELSLATGVAQLYYSMQASYQMLDLLEQTHDVIDYAVKAHQSKVAHGLEAQVPFHGARA
QILAVDKQIVAVKGQITETRESLRALIGAGASDMPEIRPVALPQVQTGIPATLSYELLAR
RPDLQAMRWYVQASLDQVDSARALFYPSFDIKAFFGLDSIHLHTLFKKTSRQFNFIPGLK
LPLFDGGRLNANLEGTRAASNMMIERYNQSVLNAVRDVAVNGTRLQTLNDEREMQAERVE
ATRFTQRAAEAAYQRGLTSRLQATEARLPVLAEEMSLLMLDSRRVIQSIQLMKSLGGGYQ
AGPVVEKK