Protein Info for ECD_03922 in Escherichia coli BL21

Annotation: phage shock protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 transmembrane" amino acids 6 to 37 (32 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details PF09583: Phageshock_PspG" amino acids 1 to 64 (64 residues), 88.5 bits, see alignment E=1.5e-29 TIGR02975: phage shock protein G" amino acids 2 to 64 (63 residues), 90 bits, see alignment E=4.9e-30

Best Hits

Swiss-Prot: 100% identical to PSPG_ECOLI: Phage shock protein G (pspG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4050)

Predicted SEED Role

"Phage shock protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (80 amino acids)

>ECD_03922 phage shock protein G (Escherichia coli BL21)
MLELLFVIGFFVMLMVTGVSLLGIIAALVVATAIMFLGGMLALMIKLLPWLLLAIAVVWV
IKAIKAPKVPKYQRYDRWRY