Protein Info for ECD_03845 in Escherichia coli BL21

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 3 to 456 (454 residues), 717.1 bits, E=5e-220
• PF00206: Lyase_1
  • amino acids 6 to 301 (296 residues), 351.1 bits, E=6.3e-109
• PF14698: ASL_C2
  • amino acids 364 to 431 (68 residues), 100.4 bits, E=6.4e-33

Best Hits

Swiss-Prot: 100% identical to ARLY_ECOLC: Argininosuccinate lyase (argH) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 100% identity to eco:b3960)

MetaCyc: 100% identical to argininosuccinate lyase (Escherichia coli K-12 substr. MG1655)
Argininosuccinate lyase. [EC: 4.3.2.1]

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Protein Sequence (457 amino acids)

>ECD_03845 argininosuccinate lyase (Escherichia coli BL21)
MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEE
ALNVLLEDVRARPQQILESDAEDIHSWVEGKLIDKVGQLGKKLHTGRSRNDQVATDLKLW
CKDTVSELLTANRQLQSALVETAQNNQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDE
SRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASATRNSLDSVSDRDHVLELLS
AAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQ
GALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLHMAALVLDGIQVKRPRCQEAA
QQGYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQGKPLEDLPLSELQKFSQVIDED
VYPILSLQSCLDKRAAKGGVSPQQVAQAIAFAQARLG