Protein Info for ECD_03786 in Escherichia coli BL21

Annotation: putative glycoporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF16966: Porin_8" amino acids 104 to 464 (361 residues), 512.7 bits, see alignment E=3.1e-158

Best Hits

KEGG orthology group: None (inferred from 100% identity to ebd:ECBD_4124)

Predicted SEED Role

"Putative glycoporin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>ECD_03786 putative glycoporin (Escherichia coli BL21)
MKKSTLSLAIGLLLACSTGMAKTQHLTLEQRMALLEERLEAAEMRAAKAEGQVKQLQTQQ
AAEIREIKAAQGNTPVNGQTTAESAKKNATSPNLLLSGYGDLKIYGDVEFNMDAESNHGL
LAMTNADVNSDPTNEQWNLNGRILLGFDGMRKLDNGYFAGFSAQPLGDMHGSVNIDDAVF
FFGKENDWKVKVGRFEAYDMFPLNQDTFVEHSGNTANDLYDDGSGYIYMMKEGRGRSNAG
GNFLVSKQLDNWYFELNTLLEDGTSLYNDGNYHGRDMEQQKNVAYLRPVIAWSPTEEFTV
SAAMEANVVNNAYGYTDSKGNFVDQSDRTGYGMSMTWNGLKTDPDNGIVVNLNTAYLDAN
NEKDFTAGINALWKRFELGYIYAHNKIDEFSGVVCDNDCWIDDEGTYTIHTIHASYQFAN
VMDMENFNIYLGTYYSILDSDGDKKHGDDTDDRYGARVRFKYFF