Protein Info for ECD_03773 in Escherichia coli BL21

Annotation: GNAT family putative N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 219 to 240 (22 residues), see Phobius details PF00583: Acetyltransf_1" amino acids 31 to 138 (108 residues), 58.7 bits, see alignment E=1.4e-19 PF13673: Acetyltransf_10" amino acids 59 to 143 (85 residues), 43.6 bits, see alignment E=5.5e-15 PF13508: Acetyltransf_7" amino acids 62 to 139 (78 residues), 40.3 bits, see alignment E=6.7e-14 PF09500: YiiD_C" amino acids 174 to 313 (140 residues), 170.1 bits, see alignment E=5.7e-54 TIGR02447: putative thioesterase domain" amino acids 181 to 314 (134 residues), 163.8 bits, see alignment E=1e-52

Best Hits

Swiss-Prot: 100% identical to YIID_ECO57: Uncharacterized protein YiiD (yiiD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b3888)

Predicted SEED Role

"GNAT family acetyltransferase YiiD potentially involved in tRNA processing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>ECD_03773 GNAT family putative N-acetyltransferase (Escherichia coli BL21)
MSQLPGLSRETRESIAMYHLRVPQTEEELERYYQFRWEMLRKPLHQPKGSERDAWDAMAH
HQMVVDEQGNLVAVGRLYINADNEASIRFMAVHPDVQDKGLGTLMAMTLESVARQEGVKR
VTCSAREDAVEFFAKLGFVNQGEITTPTTTPIRHFLMIKPVATLDDILHRGDWCAQLQQA
WYEHIPLSEKMGVRIQQYTGQKFITTMPETGNQNPHHTLFAGSLFSLATLTGWGLIWLML
RERHLGGTIILADAHIRYSKPISGKPHAVADLGALSGDLDRLARGRKARVQMQVEIFGDE
TPGAVFEGTYIVLPAKPFGPYEEGGNEEE