Protein Info for ECD_03705 in Escherichia coli BL21

Annotation: pyridoxal phosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF05116: S6PP" amino acids 4 to 73 (70 residues), 24.7 bits, see alignment E=2.5e-09 amino acids 159 to 242 (84 residues), 32.9 bits, see alignment E=7.9e-12 TIGR00099: Cof-like hydrolase" amino acids 4 to 260 (257 residues), 236 bits, see alignment E=5.2e-74 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 231 (227 residues), 92.1 bits, see alignment E=5.4e-30 PF08282: Hydrolase_3" amino acids 5 to 260 (256 residues), 208.1 bits, see alignment E=3.1e-65 PF00702: Hydrolase" amino acids 176 to 226 (51 residues), 27.6 bits, see alignment 5.4e-10

Best Hits

Swiss-Prot: 99% identical to YIGL_ECOLI: Pyridoxal phosphate phosphatase YigL (yigL) from Escherichia coli (strain K12)

KEGG orthology group: K07024, (no description) (inferred from 99% identity to eco:b3826)

MetaCyc: 99% identical to phosphosugar phosphatase YigL (Escherichia coli K-12 substr. MG1655)
Pyridoxal phosphatase. [EC: 3.1.3.74]; Sugar-phosphatase. [EC: 3.1.3.74, 3.1.3.23]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.23

Use Curated BLAST to search for 3.1.3.23 or 3.1.3.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>ECD_03705 pyridoxal phosphate phosphatase (Escherichia coli BL21)
MYQVVASDLDGTLLSPDHTLSPYAKETLKLLTARGINFVFATGRHHVDVGQIRDNLEIKS
YMITSNGARVHDLDGNLIFAHNLDRDIASDLFGVVNDNPDIITNVYRDDEWFMNRHRPEE
MRFFKEAVFKYALYEPGLLEPEGVSKVFFTCDSHEKLLPLEQAINARWGDRVNVSFSTLT
CLEVMAGGVSKGHALEAVAKKLGYSLKDCIAFGDGMNDAEMLSMAGKGCIMGSAHQRLKD
LHPELEVIGTNAEDAVPHYLRKLYLS