Protein Info for ECD_03678 in Escherichia coli BL21

Annotation: putative uroporphyrinogen III methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details PF04375: HemX" amino acids 130 to 363 (234 residues), 360.9 bits, see alignment E=1.6e-112

Best Hits

Swiss-Prot: 97% identical to HEMX_ECOLI: Protein HemX (hemX) from Escherichia coli (strain K12)

KEGG orthology group: K02496, uroporphyrin-III C-methyltransferase [EC: 2.1.1.107] (inferred from 100% identity to ebr:ECB_03678)

Predicted SEED Role

"Homolog of E. coli HemX protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>ECD_03678 putative uroporphyrinogen III methyltransferase (Escherichia coli BL21)
MTEQEKTSAVVEETREAVDTTSQPVATEKKSKNNTALILSAVAIAIALAAGVGLYGWGKQ
QAVNQTATSDALANQLTALQKAQESQKAELEGIIKQQAVQLEQANRQQETLAKQLDEVQQ
KVATISGSDAKTWLLAQADFLVKLAGRKLWSDQDVTTAAALLKSADASLADMNDPSLITV
RRAITDDIASLSAVSQVDYDGIILKLNQLSNQVDNLRLADNDSDGSPMDSDGEELSSSIS
EWRINLQKSWQNFMDNFITIRRRDDTAVPLLAPNQDIYLRENIRSRLLVAAQAVPRHQEE
TYRQALENVSTWVRAYYDTDDATTKAFLDEVDQLSQQNISMDLPETLQSQAMLEKLMQTR
VRNLLAQPAAGATEAKPAPAPAPAPAPAPQADTPAAAPQGE