Protein Info for ECD_03574 in Escherichia coli BL21

Annotation: D-galactonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 82 to 109 (28 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 316 to 332 (17 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 370 to 395 (26 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 385 (365 residues), 188.7 bits, see alignment E=1.5e-59 amino acids 246 to 424 (179 residues), 47.4 bits, see alignment E=1.4e-16 TIGR00881: phosphoglycerate transporter family protein" amino acids 22 to 405 (384 residues), 447 bits, see alignment E=5.7e-138 TIGR00893: D-galactonate transporter" amino acids 23 to 423 (401 residues), 494.3 bits, see alignment E=2.6e-152 PF00083: Sugar_tr" amino acids 44 to 421 (378 residues), 32.6 bits, see alignment E=4.3e-12

Best Hits

Swiss-Prot: 100% identical to DGOT_ECOLI: D-galactonate transporter (dgoT) from Escherichia coli (strain K12)

KEGG orthology group: K08194, MFS transporter, ACS family, D-galactonate transporter (inferred from 100% identity to eco:b3691)

MetaCyc: 100% identical to D-galactonate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-16

Predicted SEED Role

"D-galactonate transporter" in subsystem D-galactonate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>ECD_03574 D-galactonate transporter (Escherichia coli BL21)
MDIPVNAAKPGRRRYLTLVMIFITVVICYVDRANLAVASAHIQEEFGITKAEMGYVFSAF
AWLYTLCQIPGGWFLDRVGSRVTYFIAIFGWSVATLFQGFATGLMSLIGLRAITGIFEAP
AFPTNNRMVTSWFPEHERASAVGFYTSGQFVGLAFLTPLLIWIQEMLSWHWVFIVTGGIG
IIWSLIWFKVYQPPRLTKGISKAELDYIRDGGGLVDGDAPVKKEARQPLTAKDWKLVFHR
KLIGVYLGQFAVASTLWFFLTWFPNYLTQEKGITALKAGFMTTVPFLAAFVGVLLSGWVA
DLLVRKGFSLGFARKTPIICGLLISTCIMGANYTNDPMMIMCLMALAFFGNGFASITWSL
VSSLAPMRLIGLTGGVFNFAGGLGGITVPLVVGYLAQGYGFAPALVYISAVALIGALSYI
LLVDDVKRVG