Protein Info for ECD_03571 in Escherichia coli BL21

Annotation: DUF1375 family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07119: DUF1375" amino acids 35 to 76 (42 residues), 35.2 bits, see alignment E=6.2e-13

Best Hits

Swiss-Prot: 100% identical to YIDQ_SHIFL: Uncharacterized protein YidQ (yidQ) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b3688)

Predicted SEED Role

"Outer membrane lipoprotein YidQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>ECD_03571 DUF1375 family outer membrane protein (Escherichia coli BL21)
MIRNVLLAFMICSGMTLLGGCSSVMSHTGGKEGTYPGTRASATMIGDDETNWGTKSLAIL
DMPFTAVMDTLLLPWDVFRKDSSVRSRVEKSEANAQATNAVIPPARMPDN