Protein Info for ECD_03563 in Escherichia coli BL21

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 282 to 307 (26 residues), see Phobius details amino acids 327 to 356 (30 residues), see Phobius details amino acids 381 to 397 (17 residues), see Phobius details amino acids 411 to 428 (18 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details amino acids 460 to 481 (22 residues), see Phobius details amino acids 504 to 523 (20 residues), see Phobius details amino acids 532 to 550 (19 residues), see Phobius details PF00474: SSF" amino acids 35 to 442 (408 residues), 169.9 bits, see alignment E=4.3e-54 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 35 to 443 (409 residues), 417.1 bits, see alignment E=4.1e-129

Best Hits

Swiss-Prot: 100% identical to YIDK_ECOLI: Uncharacterized symporter YidK (yidK) from Escherichia coli (strain K12)

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 100% identity to eco:b3679)

Predicted SEED Role

"Sodium-Choline Symporter" in subsystem Choline Transport

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>ECD_03563 putative transporter (Escherichia coli BL21)
MNSLQILSFVGFTLLVAVITWWKVRKTDTGSQQGYFLAGRSLKAPVIAASLMLTNLSTEQ
LVGLSGQAYKSGMSVMGWEVTSAVTLIFLALIFLPRYLKRGIATIPDFLEERYDKTTRII
IDFCFLIATGVCFLPIVLYSGALALNSLFHVGESLQISHGAAIWLLVILLGLAGILYAVI
GGLRAMAVADSINGIGLVIGGLMVPVFGLIAMGKGSFMQGIEQLTTVHAEKLNSIGGPTD
PLPIGAAFTGLILVNTFYWCTNQGIVQRTLASKSLAEGQKGALLTAVLKMLDPLVLVLPG
LIAFHLYQDLPKADMAYPTLVNNVLPVPMVGFFGAVLFGAVISTFNGFLNSASTLFSMGI
YRRIINQNAEPQQLVTVGRKFGFFIAIVSVLVAPWIANAPQGLYSWMKQLNGIYNVPLVT
IIIMGFFFPRIPALAAKVAMGIGIISYITINYLVKFDFHFLYVLACTFCINVVVMLVIGF
IKPRATPFTFKDAFAVDMKPWKNVKIASIGILFAMIGVYAGLAEFGGYGTRWLAMISYFI
AAVVIVYLIFDSWRHRHDPAVTFTPDGKDSL