Protein Info for ECD_03546 in Escherichia coli BL21

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 74 to 98 (25 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 306 to 330 (25 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details amino acids 424 to 444 (21 residues), see Phobius details PF07690: MFS_1" amino acids 80 to 390 (311 residues), 129.7 bits, see alignment E=6.3e-42

Best Hits

Swiss-Prot: 100% identical to NEPI_ECOBW: Purine ribonucleoside efflux pump NepI (nepI) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K03445, MFS transporter, DHA1 family, purine ribonucleoside efflux pump (inferred from 100% identity to ecr:ECIAI1_3838)

MetaCyc: 100% identical to purine ribonucleoside exporter (Escherichia coli K-12 substr. MG1655)
RXN0-18; RXN0-22

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>ECD_03546 putative transporter (Escherichia coli BL21)
MDKTFTPHPVIFALFRFDLNSSSSNTVKVAKTLNASHISMLKWSAFPLKHATGNTMSEFI
AENRGADAITRPNWSAVFSVAFCVACLIIVEFLPVSLLTPMAQDLGISEGVAGQSVTVTA
FVAMFASLFITQTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGF
WAMSASLTMRLVPPRTVPKALSVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAVMGV
LCIFWIIKSLPSLPGEPSHQKQNTFRLLQRPGVMAGMIAIFMSFAGQFAFFTYIRPVYMN
LAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSVKLALAGAPLILAVSALVLTLWGSDK
IIATGVAIIWGLTFALVPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAAIGGYALD
NIGLTSPLMLSGTLMLLTALLVTAKVKMKKS