Protein Info for ECD_03520 in Escherichia coli BL21

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 359 to 383 (25 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details amino acids 424 to 445 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 39 to 218 (180 residues), 26.7 bits, see alignment E=2.6e-10 PF07690: MFS_1" amino acids 49 to 409 (361 residues), 196.5 bits, see alignment E=6.1e-62

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to ebr:ECB_03520)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>ECD_03520 hypothetical protein (Escherichia coli BL21)
MATPSCVVARSFITSGGVIMSQDINNNIAVSKHRRIIRQLRWWMLILFLMGVTVNYITRN
SLGILAPELKDSLGITTEQYSWIVGGFQLAYTLFQPLCGWLIDVIGLKIGFMICASLWGI
ACLLHAGAGSWIQLALLRFFMGGAEASATPANAKIIGEWFPKSERPVAAGWAGVGFSIGA
MLAPPIIYFAHASFGWQGAFMFTGALAILWVFLWWACYNTPEEHPNLSKNELNFIRQDNE
APPVKMPFLTALKTVSKNKRFYGIAIPAFMAEPAWAVMSFWVPLYLAKAYGMDLKQIALF
AWLPFLCADLGSIASGYLTKLYTRLFGLSRVNSVIASSVSGAFLMVSLAVIAFIDNPYIA
IVLISIGGFGHQIISCMLSALVVESFDKGQMATVNGMRGSAAWIASFLFSLIIGVTADKI
GFNPLFIAMGFFDLIGAFFLVTFIAERRKKRT