Protein Info for ECD_03473 in Escherichia coli BL21

Annotation: LPS(HepIII)-glucuronic acid glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF13641: Glyco_tranf_2_3" amino acids 8 to 128 (121 residues), 42.3 bits, see alignment E=1.2e-14 PF10111: Glyco_tranf_2_2" amino acids 9 to 110 (102 residues), 44.6 bits, see alignment E=2e-15 PF00535: Glycos_transf_2" amino acids 9 to 137 (129 residues), 131.6 bits, see alignment E=4.4e-42

Best Hits

Swiss-Prot: 100% identical to YIBD_ECOLI: Uncharacterized glycosyltransferase YibD (yibD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3615)

MetaCyc: 100% identical to UDP-glucuronate:LPS(HepIII) glycosyltransferase (Escherichia coli K-12 substr. MG1655)
Glucuronosyltransferase. [EC: 2.4.1.17]

Predicted SEED Role

"Beta-1,3-galactosyltransferase / Beta-1,4-galactosyltransferase" in subsystem LOS core oligosaccharide biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>ECD_03473 LPS(HepIII)-glucuronic acid glycosyltransferase (Escherichia coli BL21)
MMNSTNKLSVIIPLYNAGDDFRTCMESLITQTWTALEIIIINDGSTDNSVEIAKYYAENY
PHVRLLHQANAGASVARNRGIEVATGKYVAFVDADDEVYPTMYETLMTMALEDDLDVAQC
NADWCFRETGETWQSIPTDRLRSTGVLTGPDWLRMGLSSRRWTHVVWMGVYRRDVIVKNN
IKFIAGLHHQDIVWTTEFMFNALRARYTEQSLYKYYLHNTSVSRLHRQGNKNLNYQRHYI
KITRLLEKLNRNYADKIMIYPEFHQQITYEALRVCHAVRKEPDILTRQRMIAEIFTSGMY
KRLITNVRSVKVGYQALLWSFRLWQWRDKTRSHHRITRSAFNLR