Protein Info for ECD_03460 in Escherichia coli BL21

Annotation: putative adhesin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1200 1300 1400 1500 1616 transmembrane" amino acids 35 to 53 (19 residues), see Phobius details PF13018: ESPR" amino acids 1 to 48 (48 residues), 56.8 bits, see alignment (E = 4.6e-19) PF05658: YadA_head" amino acids 92 to 112 (21 residues), 17.6 bits, see alignment (E = 7.7e-07) amino acids 116 to 142 (27 residues), 19.5 bits, see alignment (E = 2e-07) amino acids 158 to 182 (25 residues), 24.5 bits, see alignment (E = 5.2e-09) amino acids 189 to 212 (24 residues), 18.3 bits, see alignment (E = 4.8e-07) amino acids 200 to 226 (27 residues), 23.8 bits, see alignment (E = 9.3e-09) amino acids 228 to 253 (26 residues), 25 bits, see alignment (E = 3.7e-09) amino acids 258 to 281 (24 residues), 26.3 bits, see alignment (E = 1.5e-09) amino acids 283 to 308 (26 residues), 24.5 bits, see alignment (E = 5.6e-09) amino acids 300 to 323 (24 residues), 22.6 bits, see alignment (E = 2.2e-08) amino acids 311 to 335 (25 residues), 19.7 bits, see alignment (E = 1.7e-07) amino acids 327 to 351 (25 residues), 25.8 bits, see alignment (E = 2.1e-09) amino acids 353 to 379 (27 residues), 18.6 bits, see alignment (E = 3.9e-07) amino acids 1099 to 1125 (27 residues), 30.5 bits, see alignment (E = 6.9e-11) amino acids 1262 to 1285 (24 residues), 19.5 bits, see alignment (E = 1.9e-07) amino acids 1392 to 1409 (18 residues), 14.1 bits, see alignment (E = 1e-05) amino acids 1397 to 1423 (27 residues), 30.2 bits, see alignment (E = 8.7e-11) amino acids 1411 to 1436 (26 residues), 17.4 bits, see alignment (E = 9.4e-07) PF05662: YadA_stalk" amino acids 383 to 422 (40 residues), 28.8 bits, see alignment (E = 2.8e-10) amino acids 479 to 522 (44 residues), 36.7 bits, see alignment (E = 9.1e-13) amino acids 570 to 614 (45 residues), 38.2 bits, see alignment (E = 3.1e-13) amino acids 655 to 698 (44 residues), 41 bits, see alignment (E = 4.3e-14) amino acids 733 to 774 (42 residues), 34.9 bits, see alignment (E = 3.4e-12) amino acids 834 to 874 (41 residues), 28.8 bits, see alignment (E = 2.7e-10) amino acids 933 to 973 (41 residues), 29.3 bits, see alignment (E = 1.9e-10) amino acids 1028 to 1071 (44 residues), 36.3 bits, see alignment (E = 1.2e-12) amino acids 1184 to 1219 (36 residues), 34.1 bits, see alignment (E = 5.9e-12) amino acids 1320 to 1361 (42 residues), 41.8 bits, see alignment (E = 2.3e-14) amino acids 1441 to 1464 (24 residues), 39.7 bits, see alignment (E = 1.1e-13) amino acids 1494 to 1526 (33 residues), 33.1 bits, see alignment (E = 1.3e-11) PF03895: YadA_anchor" amino acids 1556 to 1616 (61 residues), 70.8 bits, see alignment (E = 1.6e-23)

Best Hits

Swiss-Prot: 92% identical to EHAG_ECO57: Autotransporter adhesin EhaG (ehaG) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to ebd:ECBD_0123)

Predicted SEED Role

"FIG00638466: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1616 amino acids)

>ECD_03460 putative adhesin (Escherichia coli BL21)
MNKIFKVIWNPATGNYTVTSETAKSRGKKSGRSKLLISALVAGGLLSSFGALANAGNDNG
QGVDYGSGSAGDGWVAIGKGAKANTFMNTSGSSTAVGYDAIAEGQYSSAIGSKPHAIGGA
SMAFGVSAISEGDRSIALGASSYSLGQYSMALGRYSKALGKLSIAMGDSSKAEGANAIAL
GNATKATEIMSIALGDTANASKAYSMALGASSVASEENAIALGRSSVASGTDSLAFGRQS
LASAANAIAIGAETEAAENATAIGNNAKAKGTNSMAMGFGSLADKVNTIALGNGSQALAD
NAIAIGQGNKADGVDAIALGNGSQSRGLNTIALGTASNATGDKSLALGSNSSANGINSVA
LGADSIADLDNTVSVGNSSLKRKIVNVKNGAIKSDSYDAINGSQLYAISDSVAKRLGGGA
AVDVDDGTVTAPTYNLKNGSKNNVGAALAVLDENTLQWDQTKGKYSAAHGTSSPTASVIT
DVADGTISASSKDAVNGSQLKATNDDVEANTANIATNTSNIATNTASIATNTTNITNLTD
SVGDLQADALLWNETKKAFSAAHGQDTTSKITNVKDADLTADSTDAVNGSQLKTTNDAVA
TNTTNIANNTSNIATNTTNISNLTETVTNLGEDALKWDKDNGVFTAAHGTETTSKITNVK
DGDLTTGSTDAVNGSQLKTTNDAVATNTTNIATNTTNISNLTETVTNLGEDALKWDKDNG
VFTAAHGNNTASKITNILDGTVTATSSDAINGSQLYDLSSNIATYFGGNASVNTDGVFTG
PTYKIGETNYYNVGDALAAINSSFSTSLGDALLWDATAGKFSAKHGTNGDASVITDVADG
EISDSSSDAVNGSQLHGVSSYVVDALGGGAEVNADGTITAPTYTIANADYDNVGDALNAI
DTTLDDALLWDADAGENGAFSAAHGKDKTASVITNVANGAISAASSDAINGSQLYTTNKY
IADALGGDAEVNADGTITAPTYTIANTEYNNVGDALDALDDNALLWDETANGGAGAYNAS
HDGKASIITNVANGSISEDSTDAVNGSQLNATNMMIEQNTQIINQLAGNTDATYIQENGA
GINYVRTNDDGLAFNDASAQGVGATAIGYNSVAKGDSSVAIGQGSYSDVDTGIALGSSSV
SSRVIAKGSRDTSITENGVVIGYDTTDGELLGALSIGDDGKYRQIINVADGSEAHDAVTV
RQLQNAIGAVATTPSKYFHANSTEEDSLAVGEDSLAMGAKTIVNGDAGIGIGLNTLVLTD
AINGIAIGSNASANHANSIAMGSGSQTTRGAQTDYTAYNMDAPQNSVGEFSVGSEDGQRQ
ITNVAAGSADTDAVNVGQLKVTDERVAQNTQSITNLNNQVTNLDTRVTNIENGIGDIVTT
GSTKYFKTNTDGVDANAQGKDSVAIGSGSIAAADNSVALGTGSVADEENTISVGSSTNQR
RITNVAAGKNATDAVNVAQLKSSEAGGVRYDTKADGSIDYSNITLGGGNGGTTRISNVSA
GVNNNDAVNYAQLKQSVQETKQYTDQRMVEMDNKLSKTESKLSGGIASAMAMTGLPQAYT
PGASMASIGGGTYNGESAVALGVSMVSANGRWVYKLQGSTNSQGEYSAALGAGIQW