Protein Info for ECD_03437 in Escherichia coli BL21

Annotation: putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 337 to 362 (26 residues), see Phobius details amino acids 383 to 408 (26 residues), see Phobius details amino acids 420 to 445 (26 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 25 to 462 (438 residues), 331.6 bits, see alignment E=3.2e-103 PF13347: MFS_2" amino acids 27 to 448 (422 residues), 245.6 bits, see alignment E=1.1e-76 PF07690: MFS_1" amino acids 40 to 361 (322 residues), 38.7 bits, see alignment E=9.2e-14 PF12832: MFS_1_like" amino acids 45 to 359 (315 residues), 26.3 bits, see alignment E=6e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to ecm:EcSMS35_3908)

Predicted SEED Role

"Putative permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>ECD_03437 putative permease (Escherichia coli BL21)
MTSTPITTADIAKGKIDDALSVREKIGYGLGDAGGTVITCLIMNFLTFFYTDVFGLTPAL
VGTLFIALRVFDAISDPVMGVIADRTQSRWGRFRPWQLWIAIPIGIIGILTFTVPDASMG
VKIAWAFGTYLLLSVGYTAINVPYCALINTMTTRHNEVISCQSWRFVLCGVAGFLVSVGL
PWMVDLFGQGNAARGYQLGVGVLCAIAVVMFLCCFFWVRERVPLSTMGKFTLREHLAGLR
NNDQLLLMLVMSFLLINVFNIRGGGYMYFITYVLQGSTGYTSLFFTMVTFASIIGSVIVS
PLTRRFDTVKIYYYTNLLLAALAVLMWFLPSGPAYQTLWLAVILGNGVILGFTLPLHFSL
MAFADDYGEWKTRVRSSGMNFAFNLFFIKLAWASSAGIISLLFIFVAYQPGVENQTASSL
GGIAAMETLLPALFHLLLAGAIRFCKLNNPMMSRIATDLRQRHVQP