Protein Info for ECD_03433 in Escherichia coli BL21

Annotation: 3-keto-L-gulonate 6-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00215: OMPdecase
  • amino acids 4 to 204 (201 residues), 150 bits, E=4.8e-48

Best Hits

Swiss-Prot: 99% identical to SGBH_ECOLI: 3-keto-L-gulonate-6-phosphate decarboxylase SgbH (sgbH) from Escherichia coli (strain K12)

KEGG orthology group: K03081, 3-dehydro-L-gulonate-6-phosphate decarboxylase [EC: 4.1.1.85] (inferred from 99% identity to eco:b3581)

MetaCyc: 99% identical to 3-keto-L-gulonate-6-phosphate decarboxylase SgbH (Escherichia coli K-12 substr. MG1655)
3-dehydro-L-gulonate-6-phosphate decarboxylase. [EC: 4.1.1.85]

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-ascorbate degradation II (bacterial, aerobic) (7/7 steps found)
• L-ascorbate degradation I (bacterial, anaerobic) (5/5 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.85

Use Curated BLAST to search for 4.1.1.85

Protein Sequence (220 amino acids)

>ECD_03433 3-keto-L-gulonate 6-phosphate decarboxylase (Escherichia coli BL21)
MSRPLLQLALDHSSLEAAQRDVTLLKDSVDIVEAGTILCLNEGLGAVKALREQCPDKIIV
ADWKVADAGETLAQQAFGAGANWMTIICAAPLATVEKGHAMAQRCGGEIQIELFGNWTLD
DARDWHRIGVRQAIYHRGRDAQASGQQWGEADLARMKALSDIGLELSITGGITPADLPLF
KDIRVKAFIAGRALAGSANPAQVAGDFHAQIDAIWGGKRA