Protein Info for ECD_03420 in Escherichia coli BL21

Annotation: D-xylose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 241 to 258 (18 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 326 to 357 (32 residues), see Phobius details amino acids 369 to 385 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 57 to 383 (327 residues), 144.7 bits, see alignment E=1.6e-46

Best Hits

Swiss-Prot: 100% identical to XYLH_ECOL6: Xylose transport system permease protein XylH (xylH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10544, D-xylose transport system permease protein (inferred from 100% identity to eco:b3568)

MetaCyc: 100% identical to xylose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-33-RXN [EC: 7.5.2.10, 7.5.2.13]

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.10 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>ECD_03420 D-xylose ABC transporter permease (Escherichia coli BL21)
MSKSNPSEVKLAVPTSGSFSGLKSLNLQVFVMIAAIIAIMLFFTWTTDGAYLSARNVSNL
LRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLGGVAAICDVWLGWPLPLTIIVTLVLG
LLLGAWNGWWVAYRKVPSFIVTLAGMLAFRGILIGITNGTTVSPTSAAMSQIGQSYLPAS
TGFIIGALGLMAFVGWQWRGRMRRQALGLQSPASTAVVGRQALTAIIVLGAIWLLNDYRG
VPTPVLLLTLLLLGGMFMETRTAFGRRIYAIGGNLEAARLSGINVERTKLAVFAINGLMV
AIAGLILSSRLGAGSPSAGNIAELDAIAACVIGGTSLAGGVGSVAGAVMGAFIMASLDNG
MSMMDVPTFWQYIVKGAILLLAVWMDSATKRRS