Protein Info for ECD_03399 in Escherichia coli BL21

Annotation: 3-methyl-adenine DNA glycosylase I, constitutive

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR00624: DNA-3-methyladenine glycosylase I" amino acids 2 to 182 (181 residues), 321.9 bits, see alignment E=4.7e-101 PF03352: Adenine_glyco" amino acids 6 to 181 (176 residues), 278.1 bits, see alignment E=1.5e-87

Best Hits

Swiss-Prot: 98% identical to 3MG1_ECOLI: DNA-3-methyladenine glycosylase 1 (tag) from Escherichia coli (strain K12)

KEGG orthology group: K01246, DNA-3-methyladenine glycosylase I [EC: 3.2.2.20] (inferred from 98% identity to eco:b3549)

MetaCyc: 98% identical to 3-methyl-adenine DNA glycosylase I, constitutive (Escherichia coli K-12 substr. MG1655)
DNA-3-methyladenine glycosylase I. [EC: 3.2.2.20]

Predicted SEED Role

"DNA-3-methyladenine glycosylase (EC 3.2.2.20)" in subsystem DNA Repair Base Excision (EC 3.2.2.20)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>ECD_03399 3-methyl-adenine DNA glycosylase I, constitutive (Escherichia coli BL21)
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACF
HQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFV
NHQPQMTQATTLSEIPTSTPASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCC
CYPGNKP