Protein Info for ECD_03398 in Escherichia coli BL21

Annotation: autotransporter beta-domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF03797: Autotransporter" amino acids 88 to 209 (122 residues), 45.6 bits, see alignment E=4e-16 TIGR01414: outer membrane autotransporter barrel domain" amino acids 88 to 232 (145 residues), 21.7 bits, see alignment E=4.7e-09

Best Hits

Swiss-Prot: 99% identical to YHJY_ECOLI: Uncharacterized protein YhjY (yhjY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ecx:EcHS_A3750)

Predicted SEED Role

"FIG00543870: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>ECD_03398 autotransporter beta-domain protein (Escherichia coli BL21)
MIIKKSGGRWQLSLLASVVISAFFLNTAYAWQQEYIVDTQPGHSTERYTWDSDHQPDYND
ILSQRIQSSQRALGLEVNLAEETPVDVTSSMSMGWNFPLYEQVTTGPVAALHYDGTTTSM
YNEFGDSTTTLTDPLWHASVSTLGWRVDSRLGDLRPWAQISYNQQFGENIWKAQSGLSRM
TATNQNGNWLDVTVGADMLLNQNIAAYAALSQAENTTNNSDYLYTMGVSARF