Protein Info for ECD_03389 in Escherichia coli BL21
Annotation: toxic polypeptide, small
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 97% identical to LDRD_ECOLI: Small toxic polypeptide LdrD (ldrD) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 100% identity to ecg:E2348C_3782)Predicted SEED Role
"corresponds to STY4175 from Accession AL513382: Salmonella typhi CT18"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (35 amino acids)
>ECD_03389 toxic polypeptide, small (Escherichia coli BL21) MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK