Protein Info for ECD_03368 in Escherichia coli BL21

Annotation: putative DNA-binding transcriptional response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF04545: Sigma70_r4" amino acids 139 to 177 (39 residues), 25.5 bits, see alignment 1.5e-09 PF08281: Sigma70_r4_2" amino acids 139 to 177 (39 residues), 32.1 bits, see alignment 1.5e-11 PF00196: GerE" amino acids 140 to 195 (56 residues), 77.7 bits, see alignment E=8.2e-26

Best Hits

Swiss-Prot: 100% identical to YHJB_ECOLI: Putative HTH-type transcriptional regulator YhjB (yhjB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3520)

Predicted SEED Role

"Putative regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>ECD_03368 putative DNA-binding transcriptional response regulator (Escherichia coli BL21)
MQIVMFDRQSIFIHGMKISLQQRIPGVSIQGASQADELWQKLESYPEALVMLDGDQDGEF
CYWLLQKTVVQFPEVKVLITATDCNKRWLQEVIHFNVLAIVPRDSTVETFALAVNSAAMG
MMFLPGDWRTTPEKDIKDLKSLSARQREILTMLAAGESNKEIGRALNISTGTVKAHLESL
YRRLEVKNRTQAAMMLNISS