Protein Info for ECD_03349 in Escherichia coli BL21

Annotation: glutathione oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 TIGR01421: glutathione-disulfide reductase" amino acids 3 to 450 (448 residues), 725.4 bits, see alignment E=1.7e-222 PF07992: Pyr_redox_2" amino acids 5 to 318 (314 residues), 241.1 bits, see alignment E=3.7e-75 PF13738: Pyr_redox_3" amino acids 90 to 302 (213 residues), 53.8 bits, see alignment E=3.6e-18 PF00070: Pyr_redox" amino acids 169 to 248 (80 residues), 71.6 bits, see alignment E=1.3e-23 PF02852: Pyr_redox_dim" amino acids 339 to 449 (111 residues), 126.2 bits, see alignment E=1.4e-40

Best Hits

Swiss-Prot: 100% identical to GSHR_ECOLI: Glutathione reductase (gor) from Escherichia coli (strain K12)

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 100% identity to eco:b3500)

MetaCyc: 100% identical to glutathione reductase (NADPH) (Escherichia coli K-12 substr. MG1655)
Glutathione-disulfide reductase. [EC: 1.8.1.7]

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>ECD_03349 glutathione oxidoreductase (Escherichia coli BL21)
MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIR
EAIHMYGPDYGFDTTINKFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDA
KTLEVNGETITADHILIATGGRPSHPDIPGVEYGIDSDGFFALPALPERVAVVGAGYIAV
ELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNADG
SLTLELEDGRSETVDCLIWAIGREPANDNINLEAAGVKTNEKGYIVVDKYQNTNIEGIYA
VGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAR
EQYGDDQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFA
VALKMGATKKDFDNTVAIHPTAAEEFVTMR