Protein Info for ECD_03345 in Escherichia coli BL21

Annotation: dipeptide and tripeptide permease B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 382 to 407 (26 residues), see Phobius details amino acids 415 to 437 (23 residues), see Phobius details amino acids 457 to 479 (23 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 9 to 483 (475 residues), 609.2 bits, see alignment E=3.1e-187 PF07690: MFS_1" amino acids 27 to 318 (292 residues), 50.1 bits, see alignment E=2.1e-17 PF00854: PTR2" amino acids 82 to 444 (363 residues), 345.7 bits, see alignment E=3.5e-107

Best Hits

Swiss-Prot: 100% identical to DTPB_ECOLI: Dipeptide and tripeptide permease B (dtpB) from Escherichia coli (strain K12)

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 100% identity to eco:b3496)

MetaCyc: 100% identical to dipeptide/tripeptide:H+ symporter DtpB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-267; TRANS-RXN0-288

Predicted SEED Role

"Di/tripeptide permease DtpB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>ECD_03345 dipeptide and tripeptide permease B (Escherichia coli BL21)
MNTTTPMGMLQQPRPFFMIFFVELWERFGYYGVQGVLAVFFVKQLGFSQEQAFVTFGAFA
ALVYGLISIGGYVGDHLLGTKRTIVLGALVLAIGYFMTGMSLLKPDLIFIALGTIAVGNG
LFKANPASLLSKCYPPKDPRLDGAFTLFYMSINIGSLIALSLAPVIADRFGYSVTYNLCG
AGLIIALLVYIACRGMVKDIGSEPDFKPMSFSKLLYVLLGSVVMIFVCAWLMHNVEVANL
VLIVLSIVVTIIFFRQAFKLDKTGRNKMFVAFVLMLEAVVFYILYAQMPTSLNFFAINNV
HHEILGFSINPVSFQALNPFWVVLASPILAGIYTHLGNKGKDLSMPMKFTLGMFMCSLGF
LTAAAAGMWFADAQGLTSPWFIVLVYLFQSLGELFISALGLAMIAALVPQHLMGFILGMW
FLTQAAAFLLGGYVATFTAVPDNITDPLETLPVYTNVFGKIGLVTLGVAVVMLLMVPWLK
RMIATPESH