Protein Info for ECD_03336 in Escherichia coli BL21

Annotation: ribosome-associated ATPase: ATP-binding protein/ATP-binding membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 911 transmembrane" amino acids 561 to 580 (20 residues), see Phobius details amino acids 716 to 738 (23 residues), see Phobius details amino acids 766 to 789 (24 residues), see Phobius details amino acids 795 to 817 (23 residues), see Phobius details amino acids 824 to 844 (21 residues), see Phobius details amino acids 885 to 906 (22 residues), see Phobius details PF00005: ABC_tran" amino acids 28 to 176 (149 residues), 96.4 bits, see alignment E=5.9e-31 amino acids 293 to 436 (144 residues), 104.6 bits, see alignment E=1.7e-33 PF12698: ABC2_membrane_3" amino acids 569 to 903 (335 residues), 137 bits, see alignment E=2.2e-43 PF12679: ABC2_membrane_2" amino acids 669 to 909 (241 residues), 39.2 bits, see alignment E=1.3e-13 PF01061: ABC2_membrane" amino acids 719 to 874 (156 residues), 63 bits, see alignment E=7.4e-21

Best Hits

Swiss-Prot: 100% identical to RBBA_ECOLI: Ribosome-associated ATPase (rbbA) from Escherichia coli (strain K12)

KEGG orthology group: K13926, ribosome-dependent ATPase (inferred from 70% identity to bav:BAV1814)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (911 amino acids)

>ECD_03336 ribosome-associated ATPase: ATP-binding protein/ATP-binding membrane protein (Escherichia coli BL21)
MTHLELVPVPPVAQLAGVSQHYGKTVALNNITLDIPARCMVGLIGPDGVGKSSLLSLISG
ARVIEQGNVMVLGGDMRDPKHRRDVCPRIAWMPQGLGKNLYHTLSVYENVDFFARLFGHD
KAEREVRINELLTSTGLAPFRDRPAGKLSGGMKQKLGLCCALIHDPELLILDEPTTGVDP
LSRSQFWDLIDSIRQRQSNMSVLVATAYMEEAERFDWLVAMNAGEVLATGSAEELRQQTQ
SATLEEAFINLLPQAQRQAHQAVVIPPYQPENAEIAIEARDLTMRFGSFVAVDHVNFRIP
RGEIFGFLGSNGCGKSTTMKMLTGLLPASEGEAWLFGQPVDPKDIDTRRRVGYMSQAFSL
YNELTVRQNLELHARLFHIPEAEIPARVAEMSERFKLNDVEDILPESLPLGIRQRLSLAV
AVIHRPEMLILDEPTSGVDPVARDMFWQLMVDLSRQDKVTIFISTHFMNEAERCDRISLM
HAGKVLASGTPQELVEKRGAASLEEAFIAYLQEAAGQSNEAEAPPVVHDTTHAPRQGFSL
RRLFSYSRREALELRRDPVRSTLALMGTVILMLIMGYGISMDVENLRFAVLDRDQTVSSQ
AWTLNLSGSRYFIEQPPLTSYDELDRRMRAGDITVAIEIPPNFGRDIARGTPVELGVWID
GAMPSRAETVKGYVQAMHQSWLQDVASRQSTPASQSGLMNIETRYRYNPDVKSLPAIVPA
VIPLLLMMIPSMLSALSVVREKELGSIINLYVTPTTRSEFLLGKQLPYIALGMLNFFLLC
GLSVFVFGVPHKGSFLTLTLAALLYIIIATGMGLLISTFMKSQIAAIFGTAIITLIPATQ
FSGMIDPVASLEGPGRWIGEVYPTSHFLTIARGTFSKALDLTDLWQLFIPLLIAIPLVMG
LSILLLKKQEG