Protein Info for ECD_03313 in Escherichia coli BL21

Annotation: Signal Recognition Particle (SRP) receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 PF02881: SRP54_N" amino acids 211 to 276 (66 residues), 56.2 bits, see alignment E=5e-19 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 223 to 494 (272 residues), 386.2 bits, see alignment E=4e-120 PF06414: Zeta_toxin" amino acids 286 to 400 (115 residues), 29.5 bits, see alignment E=7.2e-11 PF00448: SRP54" amino acids 294 to 494 (201 residues), 267 bits, see alignment E=1.4e-83

Best Hits

Swiss-Prot: 97% identical to FTSY_ECOLI: Signal recognition particle receptor FtsY (ftsY) from Escherichia coli (strain K12)

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 99% identity to ecp:ECP_3557)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>ECD_03313 Signal Recognition Particle (SRP) receptor (Escherichia coli BL21)
MAKEKKRGFFSWLGFGQKEQTPEKETEVQNEQPVVEEIVQAQEPVKASEQAVEEQPQAHT
EAEAETFAADVVEVTEQVAESEKAQPEAEVVAQPEPVVEETPEPVAIEREELPLPEDVNA
EEVSPEEWQAEAETVEIVEAAQEEAAKEEITDEELEAQALAAEAAEEAVMVVPPAEEEQP
VEEIAQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIAD
VGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKTPFVILMV
GVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGAD
SASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTI
DASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIED
LRPFKADDFIEALFARED