Protein Info for ECD_03252 in Escherichia coli BL21

Annotation: ribosome-associated heat shock protein Hsp15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF01479: S4" amino acids 9 to 53 (45 residues), 44.6 bits, see alignment E=4.9e-16

Best Hits

Swiss-Prot: 99% identical to HSLR_ECOL6: Heat shock protein 15 (hslR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04762, ribosome-associated heat shock protein Hsp15 (inferred from 100% identity to ebr:ECB_03252)

Predicted SEED Role

"Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>ECD_03252 ribosome-associated heat shock protein Hsp15 (Escherichia coli BL21)
MKEKPAVEVRLDKWLWAARFYKTCALAREMIEGGKVHYNGQRSKPSKIVELNATLTLRQG
NDERTVIVKAITEQRRPASEAALLYEETAESVEKREKMALARKLNALTMPHPDRRPDKKE
RRDLLRFKHGDSE