Protein Info for ECD_03243 in Escherichia coli BL21

Annotation: DNA catabolic putative fimbrial transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR02515: type IV pilus secretin PilQ" amino acids 22 to 409 (388 residues), 442.6 bits, see alignment E=7.9e-137 PF03958: Secretin_N" amino acids 120 to 180 (61 residues), 44 bits, see alignment E=3.2e-15 PF00263: Secretin" amino acids 250 to 409 (160 residues), 160.7 bits, see alignment E=3.8e-51

Best Hits

Swiss-Prot: 100% identical to HOFQ_ECOLI: DNA utilization protein HofQ (hofQ) from Escherichia coli (strain K12)

KEGG orthology group: K02507, protein transport protein HofQ (inferred from 100% identity to eco:b3391)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>ECD_03243 DNA catabolic putative fimbrial transporter (Escherichia coli BL21)
MKQWIAALLLMLIPGVQAAKPQKVTLMVDDVPVAQVLQALAEQEKLNLVVSPDVSGTVSL
HLTDVPWKQALQTVVKSAGLITRQEDNILSVHSIAWQNNNIARQEAEQARAQANLPLENR
SITLQYADAGELAKAGEKLLSAKGSMTVDKRTNRLLLRDNKTALSALEQWVAQMDLPVGQ
VELSAHIVTINEKSLRELGVKWTLADAQHAGGVGQVTTLGSDLSVATATTHVGFNIGRIN
GRLLDLELSALEQKQQLDIIASPRLLASHLQPASIKQGSEIPYQVSSGESGATSVEFKEA
VLGMEVTPTVLQKGRIRLKLHISQNVPGQVLQQADGEVLAIDKQEIETQVEVKSGETLAL
GGIFTRKNKSGQDSVPLLGDIPWFGQLFRHDGKEDERRELVVFITPRLVSSE