Protein Info for ECD_03209 in Escherichia coli BL21

Annotation: putative transporter, FUSC superfamily inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 transmembrane" amino acids 20 to 36 (17 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 371 to 388 (18 residues), see Phobius details amino acids 394 to 410 (17 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details amino acids 440 to 457 (18 residues), see Phobius details amino acids 462 to 481 (20 residues), see Phobius details amino acids 487 to 509 (23 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 16 to 679 (664 residues), 924.4 bits, see alignment E=2e-282 PF12805: FUSC-like" amino acids 67 to 334 (268 residues), 240.5 bits, see alignment E=2.1e-75 PF13515: FUSC_2" amino acids 381 to 502 (122 residues), 78.1 bits, see alignment E=6.6e-26

Best Hits

Swiss-Prot: 100% identical to YHFK_ECOLI: Uncharacterized protein YhfK (yhfK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3358)

Predicted SEED Role

"FIG00638035: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (700 amino acids)

>ECD_03209 putative transporter, FUSC superfamily inner membrane protein (Escherichia coli BL21)
MFPPMWRRLIYHPDINYALRQTLVLCLPVAVGLMLGELRFGLLFSLVPACCNIAGLDTPH
KRFFKRLIIGASLFATCSLLTQLLLAKDVPLPFLLTGLTLVLGVTAELGPLHAKLLPASL
LAAIFTLSLAGYMPVWEPLLIYALGTLWYGLFNWFWFWIWREQPLRESLSLLYRELADYC
EAKYSLLTQHTDPEKALPPLLVRQQKAVDLITQCYQQMHMLSAQNNTDYKRMLRIFQEAL
DLQEHISVSLHQPEEVQKLVERSHAEEVIRWNAQTVAARLRVLADDILYHRLPTRFTMEK
QIGALEKIARQHPDNPVGQFCYWHFSRIARVLRTQKPLYARDLLADKQRRMPLLPALKSY
LSLKSPALRNAGRLSVMLSVASLMGTALHLPKSYWILMTVLLVTQNGYGATRLRIVNRSV
GTVVGLIIAGVALHFKIPEGYTLTLMLITTLASYLILRKNYGWATVGFTITAVYTLQLLW
LNGEQYILPRLIDTIIGCLIAFGGTVWLWPQWQSGLLRKNAHDALEAYQEAIRLILSEDP
QPTPLAWQRMRVNQAHNTLYNSLNQAMQEPAFNSHYLADMKLWVTHSQFIVEHINAMTTL
AREHRALTPELAQEYLQSCEIAIQRCQQRLEYDEPGSSGDANIMDAPEMQPHEGAAGTLE
QHLQRVIGHLNTMHTISSMAWRQRPHHGIWLSRKLRDSKA