Protein Info for ECD_03095 in Escherichia coli BL21

Annotation: serine endoprotease, periplasmic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR02038: periplasmic serine peptidase DegS" amino acids 2 to 352 (351 residues), 604.4 bits, see alignment E=3.3e-186 PF00089: Trypsin" amino acids 72 to 241 (170 residues), 74.2 bits, see alignment E=3.5e-24 PF13365: Trypsin_2" amino acids 80 to 215 (136 residues), 103.5 bits, see alignment E=4.5e-33 PF13180: PDZ_2" amino acids 258 to 347 (90 residues), 52.2 bits, see alignment E=1.6e-17 PF00595: PDZ" amino acids 259 to 335 (77 residues), 42.2 bits, see alignment E=2.1e-14 PF17820: PDZ_6" amino acids 283 to 325 (43 residues), 41.9 bits, see alignment 1.6e-14

Best Hits

Swiss-Prot: 100% identical to DEGS_ECOLI: Serine endoprotease DegS (degS) from Escherichia coli (strain K12)

KEGG orthology group: K04691, serine protease DegS [EC: 3.4.21.-] (inferred from 100% identity to eco:b3235)

MetaCyc: 100% identical to serine endoprotease (Escherichia coli K-12 substr. MG1655)
3.4.21.-

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>ECD_03095 serine endoprotease, periplasmic (Escherichia coli BL21)
MFVKLLRSVAIGLIVGAILLVAMPSLRSLNPLSTPQFDSTDETPASYNLAVRRAAPAVVN
VYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVG
SDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIG
LNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQL
ATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQSGGIDQLQGIVVNEVSPDGPAANAGIQV
NDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATN