Protein Info for ECD_03085 in Escherichia coli BL21

Annotation: N-acetylneuraminate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR00683: N-acetylneuraminate lyase" amino acids 5 to 297 (293 residues), 571.4 bits, see alignment E=1.9e-176 PF00701: DHDPS" amino acids 5 to 291 (287 residues), 380.1 bits, see alignment E=2.5e-118

Best Hits

Swiss-Prot: 100% identical to NANA_SHIF8: N-acetylneuraminate lyase (nanA) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K01639, N-acetylneuraminate lyase [EC: 4.1.3.3] (inferred from 100% identity to eco:b3225)

MetaCyc: 100% identical to N-acetylneuraminate lyase (Escherichia coli K-12 substr. MG1655)
N-acetylneuraminate lyase. [EC: 4.1.3.3]

Predicted SEED Role

"N-acetylneuraminate lyase (EC 4.1.3.3)" in subsystem Sialic Acid Metabolism (EC 4.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>ECD_03085 N-acetylneuraminate lyase (Escherichia coli BL21)
MATNLRGVMAALLTPFDQQQALDKASLRRLVQFNIQQGIDGLYVGGSTGEAFVQSLSERE
QVLEIVAEEAKGKIKLIAHVGCVSTAESQQLAASAKRYGFDAVSAVTPFYYPFSFEEHCD
HYRAIIDSADGLPMVVYNIPALSGVKLTLDQINTLVTLPGVGALKQTSGDLYQMEQIRRE
HPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQTAQKLQTECN
KVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFGPVDEKYLPELKALAQQLMQERG