Protein Info for ECD_03043 in Escherichia coli BL21

Annotation: protease, ATP-dependent zinc-metallo

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 98 to 119 (22 residues), see Phobius details PF06480: FtsH_ext" amino acids 5 to 93 (89 residues), 72.6 bits, see alignment E=8.6e-24 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 100 to 593 (494 residues), 822.2 bits, see alignment E=8.2e-252 PF06068: TIP49" amino acids 155 to 222 (68 residues), 24.7 bits, see alignment E=4e-09 PF07728: AAA_5" amino acids 187 to 309 (123 residues), 26.5 bits, see alignment E=1.7e-09 PF00004: AAA" amino acids 188 to 320 (133 residues), 161.2 bits, see alignment E=5.5e-51 PF17862: AAA_lid_3" amino acids 343 to 387 (45 residues), 44.5 bits, see alignment 2.7e-15 PF01434: Peptidase_M41" amino acids 401 to 591 (191 residues), 246.5 bits, see alignment E=6e-77

Best Hits

Swiss-Prot: 100% identical to FTSH_SHIFL: ATP-dependent zinc metalloprotease FtsH (ftsH) from Shigella flexneri

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 100% identity to ecg:E2348C_3457)

MetaCyc: 100% identical to ATP-dependent zinc metalloprotease FtsH (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (644 amino acids)

>ECD_03043 protease, ATP-dependent zinc-metallo (Escherichia coli BL21)
MAKNLILWLVIAVVLMSVFQSFGPSESNGRKVDYSTFLQEVNNDQVREARINGREINVTK
KDSNRYTTYIPVQDPKLLDNLLTKNVKVVGEPPEEPSLLASIFISWFPMLLLIGVWIFFM
RQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEAKEEVAELVEYLREPSRFQKL
GGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQA
KKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRP
DVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGAD
LANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMGAERRSMVMTEAQKESTAYHEAGHAI
IGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDAISASRQKLESQISTLYGGRLAEEIIY
GPEHVSTGASNDIKVATNLARNMVTQWGFSEKLGPLLYAEEEGEVFLGRSVAKAKHMSDE
TARIIDQEVKALIERNYNRARQLLTDNMDILHAMKDALMKYETIDAPQIDDLMARRDVRP
PAGWEEPGASNNSGDNGSPKAPRPVDEPRTPNPGNTMSEQLGDK