Protein Info for ECD_03014 in Escherichia coli BL21

Annotation: OM lipoprotein stimulator of MrcA transpeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details PF04348: LppC" amino acids 42 to 338 (297 residues), 167.8 bits, see alignment E=2e-53 amino acids 350 to 672 (323 residues), 287.8 bits, see alignment E=9.3e-90

Best Hits

Swiss-Prot: 100% identical to LPOA_ECOLI: Penicillin-binding protein activator LpoA (lpoA) from Escherichia coli (strain K12)

KEGG orthology group: K07121, (no description) (inferred from 100% identity to eco:b3147)

MetaCyc: 100% identical to outer membrane lipoprotein - activator of MrcA activity (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LppC putative lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (678 amino acids)

>ECD_03014 OM lipoprotein stimulator of MrcA transpeptidase (Escherichia coli BL21)
MVPSTFSRLKAARCLPVVLAALIFAGCGTHTPDQSTAYMQGTAQADSAFYLQQMQQSSDD
TRINWQLLAIRALVKEGKTGQAVELFNQLPQELNDAQRREKTLLAVEIKLAQKDFAGAQN
LLAKITPADLEQNQQARYWQAKIDASQGRPSIDLLRALIAQEPLLGAKEKQQNIDATWQA
LSSMTQEQANTLVINADENILQGWLDLQRVWFDNRNDPDMMKAGIADWQKRYPNNPGAKM
LPTQLVNVKAFKPASTNKIALLLPLNGQAAVFGRTIQQGFEAAKNIGTQPVAAQIAAAPA
ADVAEQPQPQTVDGVASPAQASVSDLTGEQPAAQPVPVSAPATSTAAVSAPANPSAELKI
YDTSSQPLSQILSQVQQDGASIVVGPLLKNNVEELLKSNTPLNVLALNQPENIENRVNIC
YFALSPEDEARDAARHIRDQGKQAPLVLIPRSSLGDRVANAFAQEWQKLGGGTVLQQKFG
STSELRAGVNGGSGIALTGSPITLRATTDSGMTTNNPTLQTTPTDDQFTNNGGRVDAVYI
VATPGEIAFIKPMIAMRNGSQSGATLYASSRSAQGTAGPDFRLEMEGLQYSEIPMLAGGN
LPLMQQALSAVNNDYSLARMYAMGVDAWSLANHFSQMRQVQGFEINGNTGSLTANPDCVI
NRNLSWLQYQQGQVVPVS