Protein Info for ECD_03010 in Escherichia coli BL21

Annotation: putative periplasmic pilin chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00345: PapD_N" amino acids 25 to 144 (120 residues), 139.7 bits, see alignment E=5.1e-45 PF02753: PapD_C" amino acids 168 to 222 (55 residues), 43.6 bits, see alignment E=2.9e-15

Best Hits

Swiss-Prot: 99% identical to YRAI_ECOLI: Probable fimbrial chaperone YraI (yraI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b3143)

Predicted SEED Role

"Chaperone protein fimC precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>ECD_03010 putative periplasmic pilin chaperone (Escherichia coli BL21)
MSKRTFAVILTLLCSFCIGQALAGGIVLQRTRVIYDASRKEAALPVANKGAETPYLLQSW
VDNIDGKSRAPFIITPPLFRLEAGDDSSLRIIKTADNLPENKESLFYINVRTIPAKKKSD
DVNANELTLVFKTRIKMFYRPAHLKGRVNDAWKSLEFKRSDHSLNIYNPTEYYVVFAGLA
VDKIDLTSKIEYIAPGEHKQLPLPASGGKNVKWAAINDYGGSSGTETRPLQ