Protein Info for ECD_02839 in Escherichia coli BL21

Annotation: putative secretion pathway protein, C-type protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR01713: type II secretion system protein C" amino acids 3 to 274 (272 residues), 144.5 bits, see alignment E=2.2e-46 PF11356: T2SSC" amino acids 3 to 142 (140 residues), 115.4 bits, see alignment E=9.9e-38

Best Hits

Swiss-Prot: 96% identical to GSPC2_ECOH1: Type II secretion system protein C 2 (gspC2) from Escherichia coli O78:H11 (strain H10407 / ETEC)

KEGG orthology group: K02452, general secretion pathway protein C (inferred from 100% identity to ebr:ECB_02839)

Predicted SEED Role

"General secretion pathway protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>ECD_02839 putative secretion pathway protein, C-type protein (Escherichia coli BL21)
MFWLMLLIISAKVAHSLWRYFSFSAEYTAVSPSANKPPRADAKTFDKNDVQLISQQNWFG
KYQPVAAPVKQPEPVPVAETRLNVVLRGIAFGARPGAVIEEGGKQQVYLQGERLGSHNAV
IEEINRDHVMLRYQGKIERLSLAEEERSTVAVTNKKAVSDEAKQAVAEPAVSAPVEIPTA
VRQALAKDPQKIFNYIQLTPVRKEGIVGYAVKPGADRSLFDVSGFREGDIAIALNQQDFT
DPRAMIALMRQLPSMDSIQLTVLRKGARHDISIALR