Protein Info for ECD_02825 in Escherichia coli BL21

Annotation: Pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01128: IspD
  • amino acids 4 to 230 (227 residues), 150.1 bits, E=8.2e-48
• PF12804: NTP_transf_3
  • amino acids 5 to 139 (135 residues), 46.2 bits, E=5.8e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ebr:ECB_02825)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• isoprene biosynthesis I (9/10 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.60

Use Curated BLAST to search for 2.7.7.60

Protein Sequence (240 amino acids)

>ECD_02825 Pyrophosphorylase (Escherichia coli BL21)
MKNIAVILSGGSGARFGGTLPKQFTKLAGRAVIEYTIDAFERTELIDEIIIVSQPNYTEL
TWDYVKKNQWNKVTKIFNGGKERFDSTYSALQGLEGEDDNCNILFHDAVRPLIDETIISN
CIESLKIFEAVDVVIPSADTLVEVYDDGCISNIPNRALMRRGQTPQAFKLGTIKLAYQRA
IAEKRFSFTCDCGVVRSMVPGVRVATVMGTEANMKVTQPIDLFIAEKLLQEAGDAANLLI