Protein Info for ECD_02743 in Escherichia coli BL21

Annotation: 5-formyltetrahydrofolate cyclo-ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details TIGR02727: 5-formyltetrahydrofolate cyclo-ligase" amino acids 2 to 176 (175 residues), 171.2 bits, see alignment E=1.1e-54 PF01812: 5-FTHF_cyc-lig" amino acids 2 to 176 (175 residues), 154.5 bits, see alignment E=1.5e-49

Best Hits

Swiss-Prot: 100% identical to 5FCL_ECO57: 5-formyltetrahydrofolate cyclo-ligase (ygfA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b2912)

MetaCyc: 100% identical to putative 5-formyltetrahydrofolate cyclo-ligase (Escherichia coli K-12 substr. MG1655)
5-formyltetrahydrofolate cyclo-ligase. [EC: 6.3.3.2]

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>ECD_02743 5-formyltetrahydrofolate cyclo-ligase family protein (Escherichia coli BL21)
MIRQRRRALTPEQQQEMGQQAATRMMTYPPVVMAHTVAVFLSFDGELDTQPLIEQLWRAG
KRVYLPVLHPFSAGNLLFLNYHPQSELVMNRLKIHEPKLDVRDVLPLSRLDVLITPLVAF
DEYGQRLGMGGGFYDRTLQNWQHYKMQPVGYAHDCQLVEKLPVEEWDIPLPAVVTPSKVW
EW