Protein Info for ECD_02714 in Escherichia coli BL21

Annotation: putative hypoxanthine oxidase, molybdopterin-binding/Fe-S binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 956 TIGR03313: probable selenate reductase, molybdenum-binding subunit" amino acids 5 to 955 (951 residues), 2121.4 bits, see alignment E=0 PF01799: Fer2_2" amino acids 73 to 145 (73 residues), 45.6 bits, see alignment 1.2e-15 PF01315: Ald_Xan_dh_C" amino acids 187 to 298 (112 residues), 107.5 bits, see alignment E=9.6e-35 PF02738: MoCoBD_1" amino acids 355 to 590 (236 residues), 242.7 bits, see alignment E=6.3e-76 PF20256: MoCoBD_2" amino acids 630 to 893 (264 residues), 232.2 bits, see alignment E=1.9e-72

Best Hits

Swiss-Prot: 100% identical to XDHD_ECOLI: Probable hypoxanthine oxidase XdhD (xdhD) from Escherichia coli (strain K12)

KEGG orthology group: K12528, putative selenate reductase molybdopterin-binding subunit (inferred from 100% identity to eco:b2881)

MetaCyc: 100% identical to fused putative xanthine/hypoxanthine oxidase: molybdopterin-binding subunit and Fe-S binding subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Possible hypoxanthine oxidase XdhD (EC 1.-.-.-)" in subsystem Purine conversions (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (956 amino acids)

>ECD_02714 putative hypoxanthine oxidase, molybdopterin-binding/Fe-S binding (Escherichia coli BL21)
MIIHFTLNGAPQELTVNPGENVQKLLFNMGMHSVRNSDDGFGFAGSDAIIFNGNIVNASL
LIAAQLEKADIRTAESLGKWNELSLVQQAMVDVGVVQSGYNDPAAALIITDLLDRIAAPT
REEIDDALSGLFSRDAGWQQYYQVIELAVARKNNPQATIDIAPTFRDDLEVIGKHYPKTD
AAKMVQAKPCYVEDRVTADACVIKMLRSPHAHALITHLDVSKAEALPGVVHVITHLNCPD
IYYTPGGQSAPEPSPLDRRMFGKKMRHVGDRVAAVVAESEEIALEALKLIDVEYEVLKPV
MSIDEAMAKDAPVVHDEPVVYVAGAPDTLEDDNSHAAQRGEHMIINFPIGSRPRKNIAAS
IHGHIGDMDKGFADADVIIERTYNSTQAQQCPTETHICFTRMDGDRLVIHASTQVPWHLR
RQVARLVGMKQHKVHVIKERVGGGFGSKQDILLEEVCAWATCVTGRPVLFRYTREEEFIA
NTSRHVAKVTVKLGAKKDGRLTAVKMDFRANTGPYGNHSLTVPCNGPALSLPLYPCDNVD
FQVTTYYSNICPNGAYQGYGAPKGNFAITMALAELAEQLQIDQLEIIERNRVHEGQELKI
LGAIGEGKAPTSVPSAASCALEEILRQGREMIQWSSPKPQNGDWHIGRGVAIIMQKSGIP
DIDQANCMIKLESDGTFIVHSGGADIGTGLDTVVTKLAAEVLHCPPQDVHVISGDTDHAL
FDKGAYASSGTCFSGNAARLAAENLREKILFHGAQMLGEPVADVQLATPGVVRGKKGEVS
FRDIAHKGETGTGFGSLVGTGSYITPDFAFPYGANFAEVAVNTRTGEIRLDKFYALLDCG
TPVNPELALGQIYGATLRAIGHSMSEEIIYDAEGHPLTRDLRSYGAPKIGDIPRDFRAVL
VPSDDKVGPFGAKSISEIGVNGAAPAIATAIHDACGIWLREWHFTPEKILTALEKI