Protein Info for ECD_02702 in Escherichia coli BL21

Annotation: putative sigma-54-interacting transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 PF00158: Sigma54_activat" amino acids 272 to 439 (168 residues), 236 bits, see alignment E=8.1e-74 PF14532: Sigma54_activ_2" amino acids 273 to 444 (172 residues), 74.2 bits, see alignment E=5.3e-24 PF07728: AAA_5" amino acids 296 to 415 (120 residues), 25.5 bits, see alignment E=4.8e-09 PF18024: HTH_50" amino acids 548 to 589 (42 residues), 32.2 bits, see alignment 2.8e-11 PF02954: HTH_8" amino acids 548 to 587 (40 residues), 45.5 bits, see alignment 2e-15

Best Hits

Swiss-Prot: 100% identical to YGEV_ECOLI: Uncharacterized sigma-54-dependent transcriptional regulator YgeV (ygeV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2869)

Predicted SEED Role

"Uncharacterized sigma-54-dependent transcriptional regulator YgeV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (592 amino acids)

>ECD_02702 putative sigma-54-interacting transcriptional activator (Escherichia coli BL21)
MELATTQSVLMQIQPTIQRFARMLASVLQLEVEIVDENLCRVAGTGAYGKFLGRQLSGNS
RLLRHVLETKTEKVVTQSRFDPLCEGCDSKENCREKAFLGTPVILQDRCVGVISLIAVTH
EQQEHISDNLREFSDYVRHISTIFVSKLLEDQGPGDNISKIFATMIDNMDQGVLVVDDES
RVQFVNQTALKTLGVVQNNIIGKPIRFRPLTFESNFTHGHMQHIVSWDDKSELIIGQLHN
IQGRQLFLMAFHQSHTSFSVANAPDEPHIEQLVGECRVMRQLKRLISRIAPSPSSVMVVG
ESGTGKEVVARAIHKLSGRRNKPFIAINCAAIPEQLLESELFGYVKGAFTGASANGKTGL
IQAANTGTLFLDEIGDMPLMLQAKLLRAIEAREILPIGASSPIQVDIRIISATNQNLAQF
IAEGKFREDLFYRLNVIPITLPPLRERQEDIELLVHYFLHLHTRRLGSVYPGIAPDVVEI
LRKHRWPGNLRELSNLMEYLVNVVPSGEVIDSTLLPPNLLNNGTTEQSDVTEVSEAHLSL
DDAGGTALEEMEKQMIREALSRHNSKKLVADELGIGIATLYRKIKKYELLNT