Protein Info for ECD_02685 in Escherichia coli BL21

Annotation: galactose-inducible d-galactose regulon transcriptional repressor; autorepressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF00356: LacI" amino acids 3 to 48 (46 residues), 74.3 bits, see alignment 1e-24 PF00532: Peripla_BP_1" amino acids 60 to 296 (237 residues), 97.9 bits, see alignment E=1.5e-31 PF13407: Peripla_BP_4" amino acids 62 to 275 (214 residues), 49.9 bits, see alignment E=6.8e-17 PF13377: Peripla_BP_3" amino acids 169 to 329 (161 residues), 122.3 bits, see alignment E=4.4e-39

Best Hits

Swiss-Prot: 100% identical to GALR_ECOLI: HTH-type transcriptional regulator GalR (galR) from Escherichia coli (strain K12)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to eco:b2837)

Predicted SEED Role

"Galactose operon repressor, GalR-LacI family of transcriptional regulators" in subsystem Lactose and Galactose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>ECD_02685 galactose-inducible d-galactose regulon transcriptional repressor; autorepressor (Escherichia coli BL21)
MATIKDVARLAGVSVATVSRVINNSPKASEASRLAVHSAMESLSYHPNANARALAQQTTE
TVGLIVGDVSDPFFGAMVKAVEQVAYHTGNFLLIGNGYHNEQKERQAIEQLIRHRCAALV
VHAKMIPDADLASLMKQMPGMVLINRILPGFENRCIALDDRYGAWLATRHLIQQGHTRIG
YLCSNHSISDAEDRLQGYYDALAESGIAANDRLVTFGEPDESGGEQAMTELLGRGRNFTA
VACYNDSMAAGAMGVLNDNGIDVPGEISLIGFDDVLVSRYVRPRLTTVRYPIVTMATQAA
ELALALADNRPLPEITNVFSPTLVRRHSVSTPSLEASHHATSD