Protein Info for ECD_02648 in Escherichia coli BL21

Annotation: L-fuculose phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF00532: Peripla_BP_1" amino acids 45 to 243 (199 residues), 43.8 bits, see alignment E=3.5e-15 PF13407: Peripla_BP_4" amino acids 49 to 293 (245 residues), 55.1 bits, see alignment E=1.3e-18 PF13377: Peripla_BP_3" amino acids 157 to 310 (154 residues), 47.1 bits, see alignment E=4.5e-16

Best Hits

KEGG orthology group: K03435, LacI family transcriptional regulator, fructose operon transcriptional repressor (inferred from 100% identity to ebd:ECBD_0925)

Predicted SEED Role

"transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>ECD_02648 L-fuculose phosphate aldolase (Escherichia coli BL21)
MRLVLNGKAEQYRISVKTQTRINEYVERYGYIINHSARSLKLNKTDTLGLIVPNISNVFF
ATLAEKLEQRCRRSGYQLTISCTYDDVDYENKLTKAFIARNVDGLFIVPSTLENQQHHLR
KIRKPMVLLDRDFKYTDNALVESNNISGGEKLTQNILEAGQAPVWFLLGDAGLPSISDRL
TGYLNALAKKGITHRDWVREGPVNTPEGGYVIMEKLIEEQGCPQAFIASSLPVLEGAVRA
IRDRLGAVPPEINIGTFDEHPMLGFLANNVWSMQQDENAWAEKAFEMMLSAIEERPVKKT
VKVGMKLIKRIRKK